PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00860.1.g00290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB_related
Protein Properties Length: 1482aa    MW: 161753 Da    PI: 8.005
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00860.1.g00290.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.12.4e-09783825347
                                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                     +W++eE e++ +  +++G++ +++I++ +  ++t  +c+++++k+
  Zmw_sc00860.1.g00290.1.sm.mkhc 783 PWSKEEKEIFMEMLAKFGKD-FSKISSFLT-HKTTADCVEFYYKH 825
                                     8*****************99.********9.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.13E-15767828IPR009057Homeodomain-like
PROSITE profilePS5129315.495779830IPR017884SANT domain
SMARTSM007173.5E-10780828IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-7783827IPR009057Homeodomain-like
PfamPF002491.6E-7783825IPR001005SANT/Myb domain
PROSITE profilePS5129313.2339871038IPR017884SANT domain
SMARTSM007178.3E-69881036IPR001005SANT/Myb domain
SuperFamilySSF466893.59E-99901038IPR009057Homeodomain-like
CDDcd001672.35E-49921030No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1482 aa     Download sequence    Send to blast
MPPPDRRDYL YREGRRHDGD GGGDPLPPPD PTPPRWRDSP YPPPALRDHA RLSPRRAPSS  60
NSSGRPAPRT SSDLRLLLPP PSFPAPLNPP NRFAVSEGYY RQGGGAYDRP YPDEMPPGYT  120
PSRSDRYWVD DEGGGYKGFS RYGGGFGRRD GRDMRGSFRR APFRSYGNDL SRNHQEQPPP  180
PPGPPLWRSP LRSLAVPSYD DTGDRENQPQ VAPWRRRENR SEAAGDMRGT FWRSPFRSYD  240
NDISKNHQEH PPSSPPRRSP LRSFAVPIYD PPGTLLNKGD RDNLLRVTPW RRRENRSEAA  300
GAAGVGHVSS GQSTCPAASE KVVSAHPLAV TSPHGAEEGA PRKKARLGWG QGLAKYEKQK  360
VQGPSEPAEA VSDGSLAGTG QGVAFPAPAP ALCTSPVAVP PPPPLCTSAV DARPPPPVFC  420
ASLVAVPSPH SARCSSPVAL PSSAPVLLGC ASSVTVPAPA AAHPPCTSLV AVPSPAPGEL  480
RTVGTVAGTA PKDSPTGVTS TENVSPSTGT SKVPGSVKIC DKSCVKEHRE LSPCPKIPVV  540
QDASAKDAEM MEIETAHNAK TASSEESAAC PEGQAHAAAD VGPMKISGGA KLQIDVDNEK  600
LEGSSCRIDT DSVKADGIVD LPGGQCHFSI PRNSDAFIKE RLVLHKSRLR FKQNALTFKF  660
RTLRYLWKQD ARLLWARKQR SKSSKRIDHS SRALHFGSQR QRSTNRSRLL MPAVNSSIFP  720
TPEISDIANK MYSEFQIKCC RNYLKMPVLI INEKEKECSR FVNKNGLVED PIAVEKERVL  780
INPWSKEEKE IFMEMLAKFG KDFSKISSFL THKTTADCVE FYYKHHKSDS FREVKKLLDQ  840
RQQQKPTSNF LGAKSGKKWD REANAASLDI LGVASAVAAQ GLEYEKRVEK ISAKSLIRNG  900
SNVSFVARKS SRECLDSVSL HERESVAADV LAGICDTLSL EGMSSCITSS ADPSQMINVT  960
RMEHALTQEI DKTADDKDRL SDEECEVDPA DWNDDEKSIF IEAMNNYGKD FAQISSCVKS  1020
KSYEQCKVFF SKARKSLGLD LIHQAEADVS MPTSDTNGGS RDNQACAAEM DSAICSSQYF  1080
AKTEMDVCTT ERAMQGPSYC IISKQTEGDG SNDCDGLDVK TEEGENKADK ICTLGQKLFS  1140
DVGHRSTCGP IDINCPETTE KLEGLDDTVD QMHMQNNSAI ISSKEQLEAS IEGRSHPVLD  1200
TALVKAGNSG PPASIAAETD IKENIRQLSK MTGASSISTV STSSYQHSMP GNKLPAKPKQ  1260
HVTPLTPKDL MPVQFSSVLP DPTSIRFEGI ASITTPNFED TGNKACNALE AKDMNKYPSF  1320
KDQSQSGQHT TLFRNISGYT KHVATDSPIF SERNTSGTES TSQSDQFTVT KFQNGRSSSL  1380
GVPNTTDGIH WDRGHSEVSN GSLRPYSCNT CSEGNEQIKR PGDVKLFGQI LSHQSSQNSG  1440
SSCYQQPVMQ AHQSDQKRME RFSDPHKRNG MEFISGFQRP GK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C1e-157508321294NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D1e-157508321294NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960366.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_004960367.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_012700232.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
TrEMBLA0A096TUQ40.0A0A096TUQ4_MAIZE; Uncharacterized protein
STRINGGRMZM2G447745_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549